PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g023630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SRS
Protein Properties Length: 351aa    MW: 38104.5 Da    PI: 6.5006
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g023630.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702227.42.6e-701142782154
          DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa..........aeaaskrkrel......ks 80 
                     r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrer +qlaa  +k+ ++a          +    +r++e+      ++
  Csa03g023630.1 114 RQGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERLAQLAAFPAKRIRDAtssgggdddgD---DDRENEKngggddSC 205
                     7899****************************************************999988888777899765431...222222245677789 PP

          DUF702  81 kkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                        sal++t++++a+s+  +ets++P+e+ss+avfrc+rvss+dd++ee+aYqtavsigGhvfkGiLydqG+++
  Csa03g023630.1 206 GGGSALACTRVVNANSS-GFETSHMPPEISSPAVFRCMRVSSIDDEDEEYAYQTAVSIGGHVFKGILYDQGPSD 278
                     999***********876.9****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.5E-63117277IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-27119161IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.2E-26228276IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MAGLFYLGGR DHNKQDHQHQ DKDHNEDKSN NYLYLYKDEI YNNNKGFEIW PPQYFQQQQN  60
HVAAPTNLYS FGMVPSGGGS NNNSRSTNRS LYFNVVSDHE APVRSSTGGF TVTRQGNMNC  120
QDCGNQAKKD CPHMRCRTCC KSRGFDCQTH VKSTWVPAAK RRERLAQLAA FPAKRIRDAT  180
SSGGGDDDGD DDRENEKNGG GDDSCGGGSA LACTRVVNAN SSGFETSHMP PEISSPAVFR  240
CMRVSSIDDE DEEYAYQTAV SIGGHVFKGI LYDQGPSDHH RYSSNLTADT SQHHLNLLDS  300
TASAATTTAV TVVNSNNGSI DPSSLYTAAT AAPFNAFVAA GTPFFAPPRS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9246760.0AY924676.1 Arabidopsis thaliana hypothetical protein (At1g19790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010498401.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_010498402.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD7KI570.0D7KI57_ARALL; Putative uncharacterized protein
STRINGAT1G19790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-171SHI-related sequence 7